MuscleBearMuscleBear
balazsbalazs
mattgreatcockmattgreatcock
JacobJamessJacobJamess
RobbyShawzRobbyShawz
KinkiNicoleCummingsKinkiNicoleCummings
1sweetyRita1sweetyRita
Swipe to see who's online now!

Sub X Ch. 03

Story Info
Solving the mystery brings its own problems...
2.7k words
4.64
2.3k
3
Story does not have any rosa-blanca.ru
Share this Story

Font Size

Default Font Size

Font Spacing

Default Font Spacing

Font Face

Default Font Face

Reading Theme

Default Theme (White)
You need to Log In or Sign Up to have your customization saved in your Literotica profile.
PUBLIC BETA

Note: You can change font size, font face, and turn on dark mode by clicking the "A" icon tab in the Story Info Box.

You can temporarily switch back to a Classic Literotica® experience during our ongoing public Beta testing. Please consider leaving feedback on issues you experience or suggest improvements.

Click here

Mason went over to Wookie's. The neighbor boy went to a different school and had a friend from that school over.

"Hey Mase," Wookie said and gave him a welcoming shoulder-bump. "Remember Ji-Hun?"

Mason looked at the second Korean boy. "I think I do. A year ago? You were smaller?"

The thickly muscled Ji-Hun grinned and shook Mason's hand. "Sure was. I moved up a weight class in wrestling so I had to max that out or fall behind. The chicks dig it, too."

Ji-Hun had a sharp face, thick eyebrows and oozed confidence. His tattered white shirt bulged as he moved. His shorts ended above thick smooth calves. His muscles were big but soft.

Wookie selected their multiplayer game on the TV. "Poor Mase here still goes to an All Boys."

"Aw," Ji-Hun made. "Sucks to be you."

Mason fought a smirk off his face. "It's not so bad."

Wookie got up. "I forgot the chips."

Ji-Hun got up as well to reach for his backpack. "Almost forgot my meal, too."

Mason wouldn't get a better opportunity. With neither of them looking, he took deep gulps from both Asian boy's beer cups and pulled the stolen bottle from the victory party from his bag. He filled the cups back up, hoping it would be enough.

The host returned with a bowl of snacks, while Ji-Hun shoved three protein bars into his face.

"By the way," Mason said, "my team won their game last weekend. Cheers to that."

He took a small sip from his own beer and watched the wrestler flush down his meal with the whole cup. Wookie also seemed to drink enough in one go.

Their game began. For a minute, nothing happened.

Mason got absorbed enough that he got angry when his two teammates started slacking. It only took a glance to the side to realize why.

Wookie was going shirtless, while Ji-Hun pulled off all his clothes safe for the socks in a fluid motion. He had been freeballing, so he was instantly naked.

Before the host had even stepped out of his pants, the wrestler was already on his knees behind the skinny boy to ram his face into the ass crack.

Mason started filming when Ji-Hun pushed Wookie over and down to get better access to the hole.

With only a minimum of fingering, Ji-Hun positioned himself to fuck his little friend. That could easily injure Wookie. Substance X usually caused more sane sex than this. Should Mason step in and...

Ji-Hun reached for his dropped pants and retrieved his wallet to grab a condom and a lube pack.

Practicing safe sex even during a mindless ass-rape. Cute.

When the buff jock wrapped his dick, he cast the condom's package aside. It showed rainbow stripes and the name of a gay club. An all boys school must have seemed like a more attractive option than the wrestler had let on.

The not-so-straight big boy's dick entered the definitely straight, skinny Wookie with no effort. At least no effort on Ji-Hun's part. Wookie was struggling quite a bit, going by the grunts and grimaces.

In fact the small neighbor boy pissed onto the ground, splashing himself in the process.

Mason held the phone close to Wookie's face to record the funny expressions, the whimpers and the line of snot running into the teary-eyed boy's mouth.

They were old friends, and Mason had no reason to wish Wookie suffering, but this was just too hot not to do. Ji-Hun repositioned himself, legs closer together, and fucked like machine gun fire.

Wookie was shaken so hard it became impossible to record him as anything but a blur, so Mason focused on the blissful wrestler, who's thick body vibrated with tense muscles under soft skin.

Ji-Hun held perfectly still as he cummed. The two boys stayed in position, breathing hard.

Mason brought kitchen wipes while they separated. The wrestler got dressed within the blink of an eye. Wookie cleaned the floor of his mess before stepping into his pants.

Speech returned to them two minutes later. Mason had already prepared the next round of gaming. Only he knew what had happened in the last five minutes.

*

***

*****

***

*

Monday was weird.

When Mason stepped into history class, he saw the three players who had the same class. Strawberry blond Aiden, jarhead Toby and black hunk Lemarcus were friends, defensive tackles and... had their hands on their nipples.

For a second Mason figured he was about to witness them stripping as the lesson started but no, they simply couldn't stop the nipple play and might not even have been aware of it.

During lunch, Mason noticed a bigger than usual gang around Hudson. The self-proclaimed alpha male raised his shirt to show off... nipple studs?

The mild formula must have had an aftereffect. Monday was indeed weird.

*

***

*****

***

*

It was almost no longer surprising to have an orgy spring up around him.

Mason was showering with his own shampoo, while the other 20 or so guys who had practiced during this period started groping him and each other.

Aiden, Toby and Lemarcus were among them as usual but he had kept a closer eye on them as they shared much of his schedule.

Someone slipped a finger up Mason's ass. The teen stepped away, slipping through wet muscle boys casually in his path.

Too much infected shampoo found its way onto him. He needed to fight his way out quickly before he needed dick... yes... he... needed dick *flash* or ass... *flash* and cum...

Toby's bubble butt was right there, practically dancing at him. Mason sunk to his knees next to the entrance.

Toby's crack welcomed his hungry tongue. Toby even leaned over to give deeper access. Mason used one hand to finger his own hole, another hand to spread Toby's big cheeks and his tongue to replace the shower water with his saliva around the hot jock's hole.

Fingering himself open, Mason noticed a phone moving past his face. Was someone... recording? Yes, filming... That was a good idea. He was vaguely glad someone else filmed so he didn't need to do that. He needed ass and dick... *flash* He needed to fuck and get fucked...

He needed some air. His throat was closing up. Rimming and sucking... *flash* No, air! Mason pulled away from Toby in a panic.

Inhaler! Where was it?

He slithered along the ground, off the shower tiles and onto laminated floor. Crawling, Mason reached his locker as his vision started fading around the edges.

A button push and Mason's mind was hit with clarity.

Just then, coach entered. "What's going on?" he asked, apparently unfamiliar with the sound of 20 mindless boys fucking rabidly in an echoey shower.

Mason could only gesture, still catching his breath.

"Are they fighting?" coach asked, enraged.

Mason could have laughed but the man charged forward and was probably going to get the shock of his life when half his team turned out to be raging homosexuals.

Coach Saunders had his back toward Mason, so his face was unreadable. He was clearly about to say something when some boy in the shower splashed a load of shampoo into the trainer's face.

Sputtering and coughing, coach removed his shirt. Mason thought he needed to wipe the shampoo off, but then the teacher took off his shorts, too, and it became obvious that the man was no longer concerned about the scene before him.

The nude coach walked calmly into the shower, leaving only Mason in the locker room.

After a moment of calming his nerves, the unaffected teen athlete looked into the tiled space.

Toby's ass was still getting eaten, his square jaw trembling from pleasure - Lemarcus had taken that job, sinking his face into the bubble butt.

Jacob and Oliver were in separate corners for once. Oliver took it doggy-style from a much slimmer guy. Jacob sucked off a defense player, while someone else lined up their dick with his hole.

The coach hadn't gotten far before fingering himself open on his back with Kareem's 8.5 inches coming down his throat from above.

Aiden was getting fucked by someone smaller behind him. When Aiden bent down to push his ass out, the fucker turned out to be water-boy Naoto.

About five guys were now getting assfucked. Aiden, Jacob, Oliver and two guys Mason had no classes with. Lemarcus rose and slipped his dick into Toby. That made six.

Just before coach got to fuck a sweet teen ass, too, the spell ended. Boy after boy continued to shower, even when his dick was still hard.

Any cum spilled so far ran down the drain.

The coach and the water-boy left the shower damp and dripping. They weren't supposed to be in there, so they barely had the mind to dry themselves off before slipping back into their clothes.

Mason got dressed. Maybe tomorrow would be less weird.

*

***

*****

***

*

Nope, Tuesday was even weirder.

Multiple boys on the team had followed Hudson's example and gotten their nipples pierced. This effect lasted.

Now that Mason had seen an orgy happen when it hadn't even been practice for the whole team, he wondered how often these events occurred without him.

He had been playing with the idea of confronting coach, but obviously the man was no longer a suspect. Who else? The principal?

This was turning back into a mystery hunt.

*

***

*****

***

*

By next week, enough teammates had nipple piercings that Mason figured he might have to get one just to stay inconspicuous.

There was a full practice on Wednesday, but on his way to the locker room Mason was grabbed by a panicked Jacob and dragged into an empty classroom.

"Mase, you have to help," said the brown skinned Buff with mohawk. "It's out of control."

"Whoa," Mason said and pulled his shirt straight after Jacob had ruffled it. "What happened? Let's see coach about it."

"No!" Jacob looked around as if he feared an eavesdropper hiding in the abandoned room.

The teen bodybuilder took a deep breath. "Mason... I know you know about SubX."

"Uh..."

Substance X! The super drug that turns everyone into gay fuck zombies? Right?"

"Uh... wait..."

Jacob paced a little. "I messed up. The new version wasn't ready. The onset is super delayed. There are four guys running around who are ticking sex timebombs. They could start jerking off in public any second. Help me contain them. I'll share my SubX samples with you."

Mason's head was spinning. He took a shot from his inhaler as he noticed his own panic rise and cut his throat off.

"Okay," Mason said. "Let's go. What do I need to do?"

"The SubX was worked into deodorant. We need to find Hudson. He used it first. I let the idiot share it around before checking if it's safe."

Since the quarterback wasn't at practice, he had to already be rubbing his dick somewhere. He'd never be late.

"I know his schedule," Jacob said. "He should have been in Algebra but he wasn't."

"Wait," Mason said. "He skips sometimes, doesn't he? He keeps getting in trouble for that."

They rushed to the parking lot in front of the school and tried to spot Hudson's Porsche among the less shiny cars.

"There," Mason called out.

The car contained a naked behemoth, feet on the dashboard, fingers in his hole. A splattering of cum already decorated Hudson's chest.

Jacob hopped from one foot to another. "Fuck. There's not much we can do if anyone comes across him here."

Mason shrugged. "I think everyone who doesn't have another period is already gone."

"It'll fucking do. Okay, next up, Jool and his Asian buddy."

"TJ? I know where they hang out. Unless they already made it to detention."

"That would be catastrophic. Lead the way."

Mason jogged back into the building and into the washroom right next to the entrance. In one of the stalls - door open - Jool with the green punk style was frenching his Korean friend with the undercut. TJ was holding himself up on the water tank. Jool rubbed his dick on the boy but didn't manage to enter.

Jacob pulled the stall door closed and used a penny to turn the screw the "occupied" sign hinged on.

"Good. Thank fuck those are nicely contained."

TJ's high pitched groan reverberated through the small space as he was finally being penetrated.

Jacob leaned on the washroom door to block it. "Do you think TJ is straight? First I thought everyone who takes it up the ass on SubX is secretly gay. Turns out a lot of straight guys can get fucked once you remove certain blockades, but they still seem to stick to their innate preferences in some way. Although I wouldn't have thought there are that many natural bottoms on the team. Maybe it's more complicated."

"I still can't believe it," Mason said. "This whole time, you were the mad genius behind SubX?"

Jacob shook his head - accidentally in the same rhythm as the fucking couple banged against the stall walls.

"Mase, I'm happy to hear you think I have mad scientist potential but I was simply recruited by the inventor."

"Then who is..."

"Not telling. I'm in enough trouble."

"But you still let yourself get affected?"

Jacob grinned wide. "I was never affected. The SubX creator gives me the anti-compound every time we run a trial. I was as unaffected as you. I'm just a much, *much* better actor." The bodybuilder winked. "And better at having fun. You're Mister Stand-and-Stare half the time."

"I'm just a top," Mason defended himself. "Wait... So you were 'awake' even that time at my house?"

"At your... What are you talking about?"

Mason had a feeling he was going to regret his decision but he pulled out his phone and showed Jacob the footage of horror movie night.

The Buff laughed. "Oh my holy fucking shit. That's hilarious. I had no idea. So I *did* get the SubX experience after all. I guess it's only fair to you."

"Fair to me?"

Jacob pulled out his own phone and showed Mason a picture. It was a shirtless selfie, taken at Jacob's house. In the background was Mason, on the floor, face-fucking a muscular adult man that looked like an older, chubbier version of Jacob. Beside him was Wookie, sucking off Oliver.

"I..." Mason started. "I had sex with your uncle? When?"

"Action movie night. Two, three month ago. You used a different brand of inhaler then, right?"

"How long have these trials been happening?"

"That was one of the first. I was recruited in the initial stages. Now, let's go. I think the two lovebirds have calmed down."

The final target were two boys from the chess club. Hudson had not lent them his deodorant. He had swiped it across their faces as they had passed him in the hallway for "looking like fags". Typical Hudson, really.

It was a rare sight that two jocks barreled into the chess club room and demanded to speak to two members in private.

The scrawny boys followed with some concern but quickly started taking off their clothes in the middle of the corridor. Shoving them into a toilet stall was easy.

When they were fully nude and making out, Jacob snapped a picture and closed the stall door.

"That's it. Everyone's contained. I'll give you some of the SubX I get to keep for my own fun. Promise to be responsible. I've learned my lesson today and I hope you don't need to learn the hard way."

"Um, okay," Mason said. "One question, though. What's with all the nipple studs and rings these days? Was that the weak formula?"

"Ah, you *did* read his notes. I left those out on accident. Don't let him know or I'll be in even more trouble."

"Let who know?"

Jacob smirked. "Nice try. To answer your question. The formula has a permanent side effect. It should be ironed out by this point but the team's got very sensitive nipples now. Maybe it'll calm down. You weren't affected, were you?"

"No, but if everyone gets pierced we'll have to do it, too."

"Good point. Let's keep an eye on that."

Please rate this story
The author would appreciate your feedback.
  • COMMENTS
Anonymous
Our Comments Policy is available in the Lit FAQ
Post as:
Anonymous
3 Comments
AnonymousAnonymousover 1 year ago

This just keeps getting better.

AnonymousAnonymousover 1 year ago

This just keeps getting better.

DevonCowboyDevonCowboyover 1 year ago

Nipple piercing is fun, but let's up the ante and start seeing some cock piercing to bash those swollen prostates, or a tongue piercing to really tease those cock heads.

Share this Story

Similar Stories

A Summer at the Farm Ch. 01 Blake agrees to work at his girlfriend father's farm.in Gay Male
The Horny Club Ch. 06 Join 18yr old Todd, Tom, and Jeb down on the farm.in Gay Male
The Horny Club Ch. 05 Join 18yr old Todd, Tom, and Jeb down on the farm.in Gay Male
The Horny Club Ch. 04 Join 18yr old Todd, Tom, and Jeb down on the farm.in Gay Male
The Horny Club Ch. 03 Join 18yr old Todd, Tom, and Jeb down on the farm.in Gay Male
More Stories


"Shh, I've got you" literoticaliterotica poopy scentCnc/reluctance storiesPEACH PICKING EROTIC STORIESLiterotical cougar and anaconda"literotica revenge"Hindi bdsm sex story policewomen part 3मॅडम सरांच्या सेक्स स्टोरीPinned down and ravishing her pussy literoticblack men with fat wife ,oooh fuck me harder,cuckold ,asstrtan line mom taboo storiesliteroticiaspankthissteffinheelsfamily pussy muncher literoticliteroticatags"lesbian bdsm"literoric incest twin campingliteroyicavantyaak"literotica stories"The stripper sisters incest sexstory"public feet"Literotica belly ridingmy body crushed beneath my son.. indian LiteroticaStudent put his teacher in a chastity belt bondage literticawattpad incest threesome vacationcmnf vacation story"literotica gangbang"literotoca sleepy daughter in lawBrothers first night at big sisters house incest story.literotica taming the bossgroup sex literotic mansion jeffliterotica boss wear her panties"naked cheerleaders"little-brother at his mom and sisters mercy incest femdom sex stories stories"sex stories xxx"wife suddenly realizes she being fucked by a bigger cock literotica plantation cotton..black slave rapeliterotixaWet aunt fidgeting her crotch on my pants literotica"horny milf"Everybody loves raymond - robert the hero erotic storyasstr nonono69 secretary mcstories bunk bed feminizationmarrying widow aunt in goa sex stories "incest literotica""horny gamer""wife sex stories"liteeroticaGiantess Linda shrinks him he cums his pants as he went down her throatliterotuca boise"nipple elongate" pleasureliterotica.xomwifewatchman literotica stories: town and county confidential Ch.01"literotica loving wives""father daughter sex stories"story forced to feminization and fucked in front of his wife lireroticathe family business incest story"bdsm story"kristen's archive sodbusters storyUnder my skin. Pt 2 pg 3. Incest/taboo literoticaGangbang husband family liteorica sex novels on wattpadLance And Honey On A Vacation SEX STORIESliterorica + boss + nonconsent + babysitterliteroticca blackmail she has such a great ass"family nudist"literotica selecting a second wife polygynylite errotica mom danced in sons slumber partyDaughter in lace panties incest storiesliterioca/love of breastslierotica grandfather brother counter kitchenreluctantly milking his prostate xxx stories student